PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00484.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 244aa    MW: 27961.1 Da    PI: 4.6522
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00484.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.12.4e-5561331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePwdL  k  + +++ ewyfF +rd+ky++g r+nrat+ gyWk
  Rsa1.0_00484.1_g00025.1   6 LPPGFRFHPTDEELVNYYLKRKISGQEIEL-DIIPEVDLYKCEPWDLAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWK 90 
                              79****************************.99**************84335556888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd++v+s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Rsa1.0_00484.1_g00025.1  91 STGKDRRVTS-QSRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-654157IPR003441NAC domain
PROSITE profilePS5100560.8636156IPR003441NAC domain
PfamPF023652.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKISG QEIELDIIPE VDLYKCEPWD LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRGGYWK STGKDRRVTS QSRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKDCDD PSSLQDSYAL CRVFKKNGIC SELETEPQIQ TGQCSFTTVS  180
MEINSNNINY SNDYETMSPE VGVSSACVED VVDDKDDSWM QFITDDAWDT SSNAAAMGHG  240
QGVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-57215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382710.0KF738271.1 Brassica napus NAC transcription factor 57 (NAC57.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009145987.11e-180PREDICTED: NAC domain-containing protein 78
RefseqXP_013749472.11e-180PREDICTED: NAC domain-containing protein 86-like isoform X2
SwissprotQ9FFI52e-91NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM4E0D91e-180M4E0D9_BRARP; Uncharacterized protein
STRINGBra022236.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85042839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-168NAC domain containing protein 57